PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g13250.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 434aa    MW: 46093.6 Da    PI: 7.7647
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g13250.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.9e-40100160262
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  Zjn_sc00002.1.g13250.1.am.mkhc 100 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 160
                                     7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2797149IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32102158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.929104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MAECRAGGGG GGGDGLIKLF GKTIPVPEAA TAVGDADRDL QQSGSNTTEP KGHETTLPDS  60
TGSPSQQGVT DTEESSAENN SLADQQQGDP TKQKENLKKP DKILPCPRCN SMDTKFCYYN  120
NYNINQPRHF CKNCQRYWTA GGAMRNVPVG AGRRKSKSAS AASHFLQRVR AALPVDPLCI  180
SAKINGTVLS FGSDTSSLDL TEQKKHLKEK LVPVTRIKNV DDQSIGSCAG EGSPKGGEPK  240
LINQKEQVVT ADKSASVVQH PCMNGVTMWP FSCAPPPACY TSGIPILFYP AAAAYWGCMV  300
PGAWNSPWLS HFQSEYATSP SSASPASIKS NCFTSGKRPR DGDEEGNAPG NGKVWVPKTI  360
RIDDADEVAR SSILSLIGIN GDKVGKDGKG CKLSSIFEPK DEAETATHAI INGLPFLQGN  420
PAALSRSLTF QEGS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985552.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLK4AAA50.0K4AAA5_SETIT; Uncharacterized protein
STRINGSi035812m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-49cycling DOF factor 3